- Recombinant Escherichia coli Uncharacterized protein ybfB (ybfB)
- MyBioSource.com
- Pricing InfoSupplier PageView Company Product Page
- MBS1114266
- Uncharacterized protein ybfB (ybfB)
- ECK0690, JW0691
- 1-108
- E Coli or Yeast
- 12,557 Da
- Recombinant Protein
- >90%
- This item requires custom production and lead time is between 5-9 weeks. We can custom produce according to your specifications
- 1 mg (E Coli Derived)
Sequence
MKYIIFLFRAIWLALSLLILFFSMHRLSLLDSTRDVSELISLMSYGMMVICFPTGIVFFIALIFIGTVSDIIGVRIDSKYIMAIIIWLYFLSGGYIQWFVLSKRIINK